DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and dnajc5ga

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_955917.1 Gene:dnajc5ga / 322863 ZFINID:ZDB-GENE-030131-1583 Length:199 Species:Danio rerio


Alignment Length:77 Identity:37/77 - (48%)
Similarity:59/77 - (76%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKDYYKILGIERNASSEDVKKGYRRMALRYHPDKN-DHPQAEEQFREVVAAFEVLFDKEKREIYD 65
            |...||:||:|:.|::||:|:.||::||:|||||| |:|:|.|:|:|:..|..:|.|:.||:|||
Zfish    19 GDSLYKVLGLEKGATAEDIKRAYRKLALKYHPDKNPDNPEAAEKFKEINNANSILTDETKRKIYD 83

  Fly    66 QHGEEGLKCDDE 77
            ::|..||...::
Zfish    84 EYGSMGLYVSEQ 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 31/61 (51%)
dnajc5gaNP_955917.1 DnaJ 21..>90 CDD:223560 34/68 (50%)
DnaJ 21..83 CDD:278647 31/61 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.