powered by:
Protein Alignment CG7130 and Dnajc18
DIOPT Version :9
Sequence 1: | NP_649380.1 |
Gene: | CG7130 / 40450 |
FlyBaseID: | FBgn0037151 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006254608.1 |
Gene: | Dnajc18 / 291677 |
RGDID: | 1310237 |
Length: | 357 |
Species: | Rattus norvegicus |
Alignment Length: | 68 |
Identity: | 32/68 - (47%) |
Similarity: | 50/68 - (73%) |
Gaps: | 0/68 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYDQH 67
::||.|||:..|||.|::||.|:::||::|||||..|.|.:.|:.:..||.||.:.:||..||::
Rat 81 RNYYDILGVSHNASDEELKKAYKKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRLRYDEY 145
Fly 68 GEE 70
|:|
Rat 146 GDE 148
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7130 | NP_649380.1 |
DnaJ |
4..65 |
CDD:278647 |
28/60 (47%) |
Dnajc18 | XP_006254608.1 |
DnaJ |
82..143 |
CDD:278647 |
28/60 (47%) |
DUF1977 |
250..349 |
CDD:286411 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.