DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and Dnajb9

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_038788.2 Gene:Dnajb9 / 27362 MGIID:1351618 Length:222 Species:Mus musculus


Alignment Length:142 Identity:46/142 - (32%)
Similarity:66/142 - (46%) Gaps:35/142 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYDQH 67
            |.||.|||:.::||...:||.:.::|::||||||..|.||.:|||:..|:|.|.|...|:.||..
Mouse    25 KSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANSRKEYDTI 89

  Fly    68 GE------EGLKCDDEPAATFAQPTPDMLPFMCAVGGTVLFAF-AAYKTFQFFNRKKEA------ 119
            |.      :|.:.:..|   |.|              :..|.| ..:|.|.||.:.:..      
Mouse    90 GHSAFTNGKGQRGNGSP---FEQ--------------SFNFNFDDLFKDFNFFGQNQNTRSKKHF 137

  Fly   120 -----THGDGSS 126
                 |..||||
Mouse   138 ENHFHTRQDGSS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 27/60 (45%)
Dnajb9NP_038788.2 DnaJ 26..87 CDD:278647 27/60 (45%)
Divergent targeting domain. /evidence=ECO:0000305 91..222 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.