DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and mug185

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_593763.1 Gene:mug185 / 2542938 PomBaseID:SPAC6B12.08 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:160 Identity:43/160 - (26%)
Similarity:75/160 - (46%) Gaps:40/160 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAE---EQFREVVAAFEVLFDKEKREIYD 65
            |.|:||.:..::..:::|..||::||:||||:|  |..|   |.|.::.||:.:|.:.:||:.::
pombe     9 DCYEILQVNHDSDLQEIKANYRKLALQYHPDRN--PGIEDYNEIFSQINAAYNILSNDDKRKWHE 71

  Fly    66 ----------------QHGEEGLKCDDEPAATFAQ---------PTPDMLPFMCAVGGTV-LFAF 104
                            ||.:...|...|..:.|.:         .:.|.||   .:|.|. |:.:
pombe    72 KDYLRNQYSVQIEDVLQHLQTIEKIPFESTSAFVERLRQDEKIAGSTDDLP---TLGDTTWLWTY 133

  Fly   105 A--AYKTFQFFNRKK----EATHGDGSSSD 128
            |  .|:.:..|:.||    ||.:.:...||
pombe   134 AKPIYQKWLRFSTKKSFEWEALYNEEEESD 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 23/63 (37%)
mug185NP_593763.1 DnaJ 9..71 CDD:278647 23/63 (37%)
zf-C2H2_2 <260..314 CDD:289522
zf-C2H2_jaz 272..295 CDD:288983
C2H2 Zn finger 272..294 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.