powered by:
Protein Alignment CG7130 and SPBC3E7.11c
DIOPT Version :9
Sequence 1: | NP_649380.1 |
Gene: | CG7130 / 40450 |
FlyBaseID: | FBgn0037151 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_596098.1 |
Gene: | SPBC3E7.11c / 2540676 |
PomBaseID: | SPBC3E7.11c |
Length: | 355 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 71 |
Identity: | 33/71 - (46%) |
Similarity: | 51/71 - (71%) |
Gaps: | 2/71 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDYYKILGIERNASSEDVKKGYRRMALRYHPDKN-DHPQ-AEEQFREVVAAFEVLFDKEKREIYD 65
:|||.||.|..:|..:.:||.|||:|:.|||||| ::|: |.|:|:::..|::||.|.:.||.||
pombe 8 RDYYDILNISVDADGDTIKKSYRRLAILYHPDKNRENPEAAREKFQKLAEAYQVLSDPKLREKYD 72
Fly 66 QHGEEG 71
:.|:.|
pombe 73 KLGKVG 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X251 |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 1.960 |
|
Return to query results.
Submit another query.