DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and SPBC3E7.11c

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_596098.1 Gene:SPBC3E7.11c / 2540676 PomBaseID:SPBC3E7.11c Length:355 Species:Schizosaccharomyces pombe


Alignment Length:71 Identity:33/71 - (46%)
Similarity:51/71 - (71%) Gaps:2/71 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIERNASSEDVKKGYRRMALRYHPDKN-DHPQ-AEEQFREVVAAFEVLFDKEKREIYD 65
            :|||.||.|..:|..:.:||.|||:|:.|||||| ::|: |.|:|:::..|::||.|.:.||.||
pombe     8 RDYYDILNISVDADGDTIKKSYRRLAILYHPDKNRENPEAAREKFQKLAEAYQVLSDPKLREKYD 72

  Fly    66 QHGEEG 71
            :.|:.|
pombe    73 KLGKVG 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 29/62 (47%)
SPBC3E7.11cNP_596098.1 DnaJ 8..>102 CDD:223560 33/71 (46%)
DnaJ 9..72 CDD:278647 29/62 (47%)
DnaJ-X 150..350 CDD:291006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X251
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.