powered by:
Protein Alignment CG7130 and rsp1
DIOPT Version :9
Sequence 1: | NP_649380.1 |
Gene: | CG7130 / 40450 |
FlyBaseID: | FBgn0037151 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_595625.1 |
Gene: | rsp1 / 2539951 |
PomBaseID: | SPBC11B10.05c |
Length: | 494 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 65 |
Identity: | 29/65 - (44%) |
Similarity: | 43/65 - (66%) |
Gaps: | 2/65 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAE--EQFREVVAAFEVLFDKEKREIYDQ 66
|||.|||.|..:|..::::.|.::.||||||:|...:|| .||:.:..|.|||.|.:.||::||
pombe 12 DYYTILGAESTSSYVEIRQQYLKLVLRYHPDRNPGREAEVLPQFQLIQKAHEVLKDPKLRELFDQ 76
Fly 67 66
pombe 77 76
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7130 | NP_649380.1 |
DnaJ |
4..65 |
CDD:278647 |
27/62 (44%) |
rsp1 | NP_595625.1 |
DnaJ |
12..75 |
CDD:278647 |
27/62 (44%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 1.860 |
|
Return to query results.
Submit another query.