DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7130 and psi1

DIOPT Version :9

Sequence 1:	NP_649380.1	Gene:	CG7130 / 40450	FlyBaseID:	FBgn0037151	Length:	128	Species:	Drosophila melanogaster
Sequence 2:	NP_588477.1	Gene:	psi1 / 2539002	PomBaseID:	SPCC830.07c	Length:	379	Species:	Schizosaccharomyces pombe

Alignment Length:	76	Identity:	34/76 - (44%)
Similarity:	50/76 - (65%)	Gaps:	3/76 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 YKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYDQHG-E 69
            |..|.:...||..::||.||::||:||||||  |..|::|:|:..|:|||.|.::|::|||:| .
pombe     8 YDCLEVRPEASEAELKKAYRKLALKYHPDKN--PNGEKKFKEISLAYEVLSDPQRRKLYDQYGIT 70

  Fly    70 EGLKCDDEPAA 80
            ||......|.|
pombe    71 EGNAAPPPPGA 81

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7130	NP_649380.1	DnaJ	4..65	CDD:278647	26/58 (45%)
psi1	NP_588477.1	DnaJ	2..379	CDD:223560	34/76 (45%)
		DnaJ	7..65	CDD:278647	26/58 (45%)
		DnaJ_C	207..368	CDD:199909
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000274
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.900