DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and DNAJB8

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_699161.1 Gene:DNAJB8 / 165721 HGNCID:23699 Length:232 Species:Homo sapiens


Alignment Length:91 Identity:42/91 - (46%)
Similarity:61/91 - (67%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIERNASSEDVKKGYRRMALRYHPDKN--DHPQAEEQFREVVAAFEVLFDKEKREIYDQ 66
            :||::||::.:||.||:||.||::|||:|||||  :..:||::|:.|..|:|||.|.:||.:||:
Human     3 NYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDR 67

  Fly    67 HGEEGLKCDDEPAATFAQPTPDMLPF 92
            .|     ||...|...|. ||...||
Human    68 AG-----CDSWRAGGGAS-TPYHSPF 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 31/62 (50%)
DNAJB8NP_699161.1 DnaJ 3..>106 CDD:223560 42/91 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5179
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.