DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and DNAJB7

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_660157.1 Gene:DNAJB7 / 150353 HGNCID:24986 Length:309 Species:Homo sapiens


Alignment Length:157 Identity:54/157 - (34%)
Similarity:80/157 - (50%) Gaps:48/157 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIERNASSEDVKKGYRRMALRYHPDKN--DHPQAEEQFREVVAAFEVLFDKEKREIYDQ 66
            |||::||::|.||.||:||.|.::||::|||||  :..:||.:|:||..|:|||.:.|||:|||:
Human     3 DYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKRDIYDK 67

  Fly    67 HGEEGLK-----CDDEPAATFAQPTPDML---------PFMCAVGGTVLFAFAAYKTFQFF---- 113
            :|.|||.     .|||....|....||.:         ||                :|.||    
Human    68 YGTEGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPF----------------SFHFFEDSL 116

  Fly   114 ------------NRKKEATHGDGSSSD 128
                        ||.::|.:...::|:
Human   117 EDLLNRPGSSYGNRNRDAGYFFSTASE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 33/62 (53%)
DNAJB7NP_660157.1 DnaJ 2..>101 CDD:223560 45/97 (46%)
DnaJ 3..66 CDD:278647 33/62 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..309
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.