DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and DNAJB4

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001304028.1 Gene:DNAJB4 / 11080 HGNCID:14886 Length:337 Species:Homo sapiens


Alignment Length:144 Identity:66/144 - (45%)
Similarity:79/144 - (54%) Gaps:37/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYD 65
            ||||||.|||||:.||.||:||.||:.||::|||||..|||||:|:||..|:|||.|.:||||||
Human     1 MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYD 65

  Fly    66 QHGEEGLK----------------CDDEPAATFAQPTPDMLPFMCAVGGTVLFAFAAYKTFQFFN 114
            |.||||||                ...:|.||||          ...||:..|..       ||.
Human    66 QFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFA----------AFFGGSNPFEI-------FFG 113

  Fly   115 RKKEATHGDGSSSD 128
            |:.    |.|..|:
Human   114 RRM----GGGRDSE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 40/60 (67%)
DNAJB4NP_001304028.1 DnaJ 1..332 CDD:223560 66/144 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158986
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.