DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7130 and DNAJB6

DIOPT Version :9

Sequence 1:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster
Sequence 2:XP_005249572.1 Gene:DNAJB6 / 10049 HGNCID:14888 Length:334 Species:Homo sapiens


Alignment Length:140 Identity:55/140 - (39%)
Similarity:83/140 - (59%) Gaps:21/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIERNASSEDVKKGYRRMALRYHPDKN--DHPQAEEQFREVVAAFEVLFDKEKREIYDQ 66
            |||::||::|:||.||:||.||::||::|||||  :..:||.:|::|..|:|||.|.:||:|||:
Human     3 DYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDK 67

  Fly    67 HGEEGLKCD-------DEP---AATFAQPTPDMLPFMCAVGGTVLFAFAAYK-TFQ-FFNRKK-- 117
            :|:|||...       |.|   ..||..|......|.   ||...|:|..:: .|: ||..::  
Human    68 YGKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFF---GGRDPFSFDFFEDPFEDFFGNRRGP 129

  Fly   118 --EATHGDGS 125
              ..:.|.||
Human   130 RGSRSRGTGS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 33/62 (53%)
DNAJB6XP_005249572.1 DnaJ 2..>106 CDD:223560 45/105 (43%)
DnaJ 3..66 CDD:278647 33/62 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.