DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSAMP and DIP-zeta

DIOPT Version :9

Sequence 1:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens
Sequence 2:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster


Alignment Length:355 Identity:110/355 - (30%)
Similarity:163/355 - (45%) Gaps:47/355 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    23 LPT---GLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNS-KVAWLN--RSGIIFAGHDKWSLD 81
            :||   .:.|...:|....:|:||..|....|.|.|::..| ||||::  :|.|:...:...:.:
  Fly   101 VPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRN 165

Human    82 PRVEL----EKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKI--SNISSD 140
            ||:.:    ..||...| |.|..|...|.|.|.|.:.|. ..||...||.|.|||.|  |..|||
  Fly   166 PRISVTHDKHDRHRTWY-LHINNVHEEDRGRYMCQINTV-TAKTQFGYLNVVVPPNIDDSLSSSD 228

Human   141 VTVNEGSNVTLVCMANGRPEPVITWR------------HLTPTGREFEGEEEYLEILGITREQSG 193
            |.|.||:|::|.|.|:|.|.|:|.|:            |:.   .|:||:.  |||..|:|...|
  Fly   229 VIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIV---NEWEGDT--LEITRISRLDMG 288

Human   194 KYECKAANEVSSADVKQVKVTVNYPP-TITESKSNEATTGRQASLKCEASAVPAPDFEWYR-DDT 256
            .|.|.|:|.|.....|::||:|::|| .:...:...|..|...:::|...|.|.....|.| :..
  Fly   289 AYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGP 353

Human   257 RINSANGLEIKSTEG------QSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTIPH 315
            .|:.::..::::|.|      ...||:.||:....|.|.|||.|..|.|:..:.|:....||...
  Fly   354 IIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTAS 418

Human   316 P--------IQEIGTTVHFKQKGPGSVRGI 337
            .        ..|.|...::...||.|.|.|
  Fly   419 SGIYSTDTHWGENGINNNYAYGGPDSTRSI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 31/96 (32%)
Ig 132..215 CDD:386229 37/96 (39%)
Ig_3 219..294 CDD:372822 20/82 (24%)
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 32/97 (33%)
Ig 130..200 CDD:143165 22/70 (31%)
I-set 226..310 CDD:254352 34/88 (39%)
IGc2 233..298 CDD:197706 25/69 (36%)
Ig 313..410 CDD:299845 25/96 (26%)
IG_like 325..410 CDD:214653 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143408
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.