DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSAMP and DIP-theta

DIOPT Version :9

Sequence 1:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:340 Identity:101/340 - (29%)
Similarity:157/340 - (46%) Gaps:46/340 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    34 FNRGTDNITVRQGDTAILRCVVED-KNSKVAWLN---------RSGIIFAGHDKWSLDPRVELEK 88
            |.....|:||.....|:|:|||:: :..|:|||.         ::.:|...|       |:.:..
  Fly   132 FGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNH-------RMSITH 189

Human    89 RHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQV-YLIVQVPPKISN--ISSDVTVNEGSNVT 150
            .....:.|||:.|...|:|.|.|.:.|  :|..||| ||.|.|||.|.:  .|:|:.:.||||||
  Fly   190 AEKRAWILRIRDVKESDKGWYMCQINT--DPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVT 252

Human   151 LVCMANGRPEPVITWRH------LTPTGRE---FEGEEEYLEILGITREQSGKYECKAANEVSSA 206
            |.|.|.|.|.|.||||.      ..|.|.|   :.|  .:|.|..:.|...|.|.|.|:|.:...
  Fly   253 LKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNG--SFLTIAKVNRLNMGAYLCIASNGIPPT 315

Human   207 DVKQVKVTVNYPPTI-TESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTE 270
            ..|:|.:.|::||.| .:::...|...:..:|:|::.|.|.....|.::||.|........::.|
  Fly   316 VSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFE 380

Human   271 G----QSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLF--------KRVLPTIPHPIQEIGTT 323
            .    ...||:..|..:.:|.|.|||.|.||.|:.::.|:        ..:.||:......:...
  Fly   381 SGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINTVPVVLV 445

Human   324 VHFKQKGPGSVRGIN 338
            .:.|::..||.:..|
  Fly   446 KYNKEQRYGSSQNSN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 30/100 (30%)
Ig 132..215 CDD:386229 34/93 (37%)
Ig_3 219..294 CDD:372822 20/79 (25%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 31/101 (31%)
IG_like 137..230 CDD:214653 31/101 (31%)
IG_like 240..324 CDD:214653 32/85 (38%)
IGc2 247..310 CDD:197706 27/64 (42%)
Ig 327..419 CDD:299845 25/91 (27%)
IG_like 343..420 CDD:214653 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10656
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3058
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.