DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and HLJ1

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_013884.1 Gene:HLJ1 / 855196 SGDID:S000004771 Length:224 Species:Saccharomyces cerevisiae


Alignment Length:87 Identity:31/87 - (35%)
Similarity:49/87 - (56%) Gaps:12/87 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNE--DGAKEFLRINEAHRVLIDHQRRALYDCCF 69
            :.|::|.:.|.|||||||.|:|:|:::.|||||.  ...:.|..||.|..||.:.::|::||...
Yeast    21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSIYDRIG 85

  Fly    70 QSMDVEAIIPAENANGQLPELG 91
            :..|          :.|:|..|
Yeast    86 RDPD----------DRQMPSRG 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 25/60 (42%)
DnaJ 7..>66 CDD:223560 25/60 (42%)
HLJ1NP_013884.1 DnaJ_bact 22..>154 CDD:274090 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.