DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and JJJ2

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_012373.2 Gene:JJJ2 / 853277 SGDID:S000003698 Length:583 Species:Saccharomyces cerevisiae


Alignment Length:109 Identity:32/109 - (29%)
Similarity:48/109 - (44%) Gaps:18/109 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDVYE------DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKE--FLRINEAHRVLI 57
            ||.|.|      .:|.:|||..|||.||:..::.:|:...||||.:....|  |..:..||.:|.
Yeast     1 MSQVIEPQLDRTTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHAHSILT 65

  Fly    58 DHQRRALYDCCFQSMDVEAIIPAEN----------ANGQLPELG 91
            |..::..||...:...:....|.:|          :.|..|.||
Yeast    66 DEDQKLRYDRDLKIKGLHTYQPKKNCHIFKTKAKESQGASPTLG 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 20/60 (33%)
DnaJ 7..>66 CDD:223560 20/60 (33%)
JJJ2NP_012373.2 DnaJ 13..74 CDD:395170 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.