powered by:
Protein Alignment CG7133 and CWC23
DIOPT Version :9
Sequence 1: | NP_649379.1 |
Gene: | CG7133 / 40449 |
FlyBaseID: | FBgn0037150 |
Length: | 353 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011387.2 |
Gene: | CWC23 / 852749 |
SGDID: | S000003096 |
Length: | 283 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 68 |
Identity: | 23/68 - (33%) |
Similarity: | 33/68 - (48%) |
Gaps: | 10/68 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 YQVLGLP-----RNATDS--EIKDAFRRLSLQYHPDKNEDGAK---EFLRINEAHRVLIDHQRRA 63
|.||.|| ....|. :||..:|.|:|:|||||:.|... :|..::.|..:|.:...|.
Yeast 17 YDVLELPTPLDVHTIYDDLPQIKRKYRTLALKYHPDKHPDNPSIIHKFHLLSTATNILTNADVRP 81
Fly 64 LYD 66
.||
Yeast 82 HYD 84
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
1 | 0.960 |
|
Return to query results.
Submit another query.