DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and AT1G79030

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_178024.3 Gene:AT1G79030 / 844244 AraportID:AT1G79030 Length:561 Species:Arabidopsis thaliana


Alignment Length:65 Identity:21/65 - (32%)
Similarity:38/65 - (58%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DHYQVLGLPRN-ATDSEI-KDAFRRLSLQYHPDKNED---GAKEFLRINEAHRVLIDHQRRALYD 66
            :||:.||:||: ..|:.: |..:|:.::..|||||..   .::.|.::..|:.||.|..::..||
plant   294 NHYEALGVPRHKKIDAAVLKKEYRKKAMLVHPDKNMGSPLASESFKKLQSAYEVLSDFVKKRDYD 358

  Fly    67  66
            plant   359  358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 19/63 (30%)
DnaJ 7..>66 CDD:223560 19/63 (30%)
AT1G79030NP_178024.3 PT_UbiA <102..>184 CDD:412319
DnaJ 294..358 CDD:395170 19/63 (30%)
Jiv90 391..487 CDD:405571
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.