DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and AT1G72070

DIOPT Version :10

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_565034.1 Gene:AT1G72070 / 843538 AraportID:AT1G72070 Length:126 Species:Arabidopsis thaliana


Alignment Length:138 Identity:25/138 - (18%)
Similarity:49/138 - (35%) Gaps:34/138 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 YLGDILDPCVDRVIYLDSDIIVVDDITKLWNTSLTGSRIIGAPEYC---HANFTKYFTSGFWSDP 236
            :|.||:....:.:   |:..|::|   |..:::..|.      .||   .|:.|.......|.|.
plant     4 FLKDIVPAAQNNI---DTRFIILD---KAKSSAANGK------NYCIALAADETAAVHIQLWGDE 56

  Fly   237 ALPGFFSGRKPCYFNTGVMVMDLVRWREG--NYREKLETWMQIQKKKRIYDLGSLPPFLLVFAGN 299
            . ..|.:|             |:|:...|  :|.......::..|:.::..:|.   |.:.|...
plant    57 C-DAFEAG-------------DIVKLTNGIFSYVRNSGLILRAGKRGKMEKMGE---FTVAFVET 104

  Fly   300 VEAIDHRW 307
            ....:.:|
plant   105 PNISEIQW 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:395170
AT1G72070NP_565034.1 DnaJ 39..88 CDD:395170 10/62 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.