DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and ARL1

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_173822.2 Gene:ARL1 / 839024 AraportID:AT1G24120 Length:436 Species:Arabidopsis thaliana


Alignment Length:138 Identity:41/138 - (29%)
Similarity:67/138 - (48%) Gaps:19/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNED---GAKEFLRINEAHRVLIDHQRRALYDCC 68
            |.|:|||:.||:||.|||.|:|:|:|:|||||..:   .|..|..:..::.:|.|.::|..:|..
plant    20 DPYEVLGVLRNSTDQEIKSAYRKLALKYHPDKTANDPVAADMFKEVTFSYNILSDPEKRRQFDSA 84

  Fly    69 -FQSMDVEAIIPAENANGQLPELG--NPFF---------PMPPETPPASFREKLKVAAFIGGLLV 121
             |::::.|    ::.....|..||  |..|         |:..........|.|.....:..|::
plant    85 GFEAVEAE----SQELELDLSSLGAVNTVFAALFSKLGVPIKTSVSATILEEALNGRVSVDPLVL 145

  Fly   122 GTYVGYRV 129
            |..|..:|
plant   146 GQAVSKKV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 26/61 (43%)
DnaJ 7..>66 CDD:223560 26/61 (43%)
ARL1NP_173822.2 PRK14284 20..>174 CDD:237658 41/138 (30%)
DnaJ 20..82 CDD:395170 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.