DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and J3

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_189997.1 Gene:J3 / 823531 AraportID:AT3G44110 Length:420 Species:Arabidopsis thaliana


Alignment Length:161 Identity:41/161 - (25%)
Similarity:74/161 - (45%) Gaps:26/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINEAHRVLIDHQRRALYDCCFQSMD 73
            |::||:|::|:..::|.|:::.:::.||||..|..| |..:.:|:.||.|.::|.:||    ...
plant    16 YEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEK-FKELAQAYEVLSDPEKREIYD----QYG 75

  Fly    74 VEAIIPAENANGQLPELGNPFFPMPPETPPASFREKLKVAAFIGGLLVGTYVGYRVFQKPPPSIP 138
            .:|:.......|.    |:..|.:              .::|.||...|.....:..|:....:.
plant    76 EDALKEGMGGGGG----GHDPFDI--------------FSSFFGGGPFGGNTSRQRRQRRGEDVV 122

  Fly   139 VPRPIPTQELSDSHLGSLWTLSSGLLALRSK 169
            .|..:   .|.|.:||::..||....||.||
plant   123 HPLKV---SLEDVYLGTMKKLSLSRNALCSK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 19/56 (34%)
DnaJ 7..>66 CDD:223560 19/56 (34%)
J3NP_189997.1 PTZ00037 7..420 CDD:240236 41/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.