powered by:
Protein Alignment CG7133 and AT3G13310
DIOPT Version :9
Sequence 1: | NP_649379.1 |
Gene: | CG7133 / 40449 |
FlyBaseID: | FBgn0037150 |
Length: | 353 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_187939.1 |
Gene: | AT3G13310 / 820531 |
AraportID: | AT3G13310 |
Length: | 157 |
Species: | Arabidopsis thaliana |
Alignment Length: | 58 |
Identity: | 23/58 - (39%) |
Similarity: | 38/58 - (65%) |
Gaps: | 0/58 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINEAHRVLIDHQRRALYD 66
|::|.:...|:.:|||.|:|.|:..||||.:|...::|:.|::|:..|.|...||:||
plant 66 YELLKVNETASLTEIKTAYRSLAKVYHPDASESDGRDFMEIHKAYATLADPTTRAIYD 123
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0712 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.