powered by:
Protein Alignment CG7133 and AT3G12170
DIOPT Version :9
Sequence 1: | NP_649379.1 |
Gene: | CG7133 / 40449 |
FlyBaseID: | FBgn0037150 |
Length: | 353 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001325582.1 |
Gene: | AT3G12170 / 820394 |
AraportID: | AT3G12170 |
Length: | 298 |
Species: | Arabidopsis thaliana |
Alignment Length: | 61 |
Identity: | 24/61 - (39%) |
Similarity: | 41/61 - (67%) |
Gaps: | 3/61 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKN---EDGAKEFLRINEAHRVLIDHQRRALYD 66
|:|||:...|:..||:.|:.:|:|:.||||| ||..::|.::.:...:|.|.::||:||
plant 49 YEVLGVEATASPQEIRKAYHKLALRLHPDKNKDDEDAKEKFQQLQKVISILGDEEKRAVYD 109
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7133 | NP_649379.1 |
DnaJ |
7..66 |
CDD:278647 |
22/59 (37%) |
DnaJ |
7..>66 |
CDD:223560 |
22/59 (37%) |
AT3G12170 | NP_001325582.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.