DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and AT3G08910

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_187503.1 Gene:AT3G08910 / 820040 AraportID:AT3G08910 Length:323 Species:Arabidopsis thaliana


Alignment Length:174 Identity:54/174 - (31%)
Similarity:82/174 - (47%) Gaps:42/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKN----EDGAKEFLRINEAHRVLIDHQRRALYDC 67
            |:|:||.:.|||.|.::|.|:|:|::::|||||    :|...:|.:|:||:.||.|.|:||:|| 
plant     4 DYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDPQKRAIYD- 67

  Fly    68 CFQSMDVEAIIPAENANGQLPELGNPFFPMPPETPPASFREKLKVA-----AFIG---------G 118
            .:....:.:..|...|.|...:.|            ||||...:.|     .|.|         |
plant    68 QYGEEGLTSQAPPPGAGGGFSDGG------------ASFRFNGRSADDIFSEFFGFTRPFGDSRG 120

  Fly   119 LLVGTYVGYR----VFQK----PPPSIPVPRPIPTQELSDSHLG 154
              .|...|:|    ||..    |..:.|:.|.:|. .|.|.:.|
plant   121 --AGPSNGFRFAEDVFSSNVVPPRKAAPIERQLPC-SLEDLYKG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 28/62 (45%)
DnaJ 7..>66 CDD:223560 28/62 (45%)
AT3G08910NP_187503.1 DnaJ 1..313 CDD:223560 54/174 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.