DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and dnajc11

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001072583.1 Gene:dnajc11 / 780038 XenbaseID:XB-GENE-942676 Length:559 Species:Xenopus tropicalis


Alignment Length:327 Identity:71/327 - (21%)
Similarity:124/327 - (37%) Gaps:82/327 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNED------GAKEFLRINEAHRVLIDHQRRAL 64
            :|:|.:|.:.|.||..|:|.::|||.:.|||||:.|      ..:.|..:::|:.||.|.|.||:
 Frog    13 DDYYSLLNVRREATQEELKASYRRLCMLYHPDKHRDPELKKQAEQLFNLVHQAYEVLSDPQSRAI 77

  Fly    65 YDCC-FQSMDVEA--IIPAENANGQLPELGNPFFPMPPETPPASFREKLKVAAFIGGLLVGTYVG 126
            ||.. .:.:::|.  ::..:....::.|   .|..:..|      ||:                 
 Frog    78 YDIYGKKGLEMEGWEVVERKRTAAEIRE---EFERLQRE------REE----------------- 116

  Fly   127 YRVFQKPPPSIPVPRPIPTQELSDSHLGSLWTL-SSGLLALRSKRILGLGKLAPWANTRVSPRTL 190
            .|:.|:..|...:...|...||.|.:......: .||...:...|:            .:| :::
 Frog   117 RRLQQRTNPKGTISVGIDATELFDRYDEDFEDIPGSGFPQIEINRM------------HIS-QSI 168

  Fly   191 NAPFSSAAKVVAKTVIRGQRAVGSSATSSSSLASAANVAVKSLPSKASVNSATETVAKTLSQGSR 255
            .||.::....:..         ||.:|.:.:...:.|:|::      .|.||..........|..
 Frog   169 EAPLTATDTAILS---------GSLSTQNGNGGGSINLALR------RVTSAKGWGELEFGAGDL 218

  Fly   256 AGPYSALKTVWSSAVSYLRSLLNWATTPKWGKATPATIAGLVHNSRP-----VWSSAAKNTLAAL 315
            .||...||        ..|:|     |||....|...:.......||     |..:..|||:..:
 Frog   219 QGPLFGLK--------IFRNL-----TPKCFFTTNCALQFSSRGIRPGLTTMVARNLDKNTMGYI 270

  Fly   316 MY 317
            .:
 Frog   271 QW 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 25/64 (39%)
DnaJ 7..>66 CDD:223560 25/64 (39%)
dnajc11NP_001072583.1 DnaJ 14..79 CDD:365959 25/64 (39%)
DUF3395 410..549 CDD:371774
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.