DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and Dnajb2

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_006245338.1 Gene:Dnajb2 / 689593 RGDID:1591035 Length:324 Species:Rattus norvegicus


Alignment Length:110 Identity:36/110 - (32%)
Similarity:57/110 - (51%) Gaps:17/110 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNED----GAKEFLRINEAHRVLIDHQRRALYDCC 68
            :|::|.:||:|:..:||.|:|:.:||:|||||.|    ..|:|..:.||:.||.|..:|.:||  
  Rat     4 YYEILDVPRSASPDDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYD-- 66

  Fly    69 FQSMDVEAII-----PAENANGQLPELGNPFFPMPPETPPASFRE 108
              ....|.:.     |:.:..|.:    .|.|.....:|...|||
  Rat    67 --RYGREGLTGAGSGPSRSETGGM----EPGFTFTFRSPEEVFRE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 25/61 (41%)
DnaJ 7..>66 CDD:223560 25/61 (41%)
Dnajb2XP_006245338.1 DnaJ 3..>110 CDD:223560 36/110 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.