powered by:
Protein Alignment CG7133 and Dnajb7
DIOPT Version :9
Sequence 1: | NP_649379.1 |
Gene: | CG7133 / 40449 |
FlyBaseID: | FBgn0037150 |
Length: | 353 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001123982.1 |
Gene: | Dnajb7 / 685839 |
RGDID: | 1589047 |
Length: | 303 |
Species: | Rattus norvegicus |
Alignment Length: | 64 |
Identity: | 26/64 - (40%) |
Similarity: | 46/64 - (71%) |
Gaps: | 4/64 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKN----EDGAKEFLRINEAHRVLIDHQRRALYD 66
|:|:|||:.|.|:..:||.|:|:::|::||||| |:..::|..:.||:.||.:.::|.:||
Rat 3 DYYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNGEKRDIYD 66
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.