DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and Dnaja1

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_075223.1 Gene:Dnaja1 / 65028 RGDID:620942 Length:397 Species:Rattus norvegicus


Alignment Length:59 Identity:29/59 - (49%)
Similarity:45/59 - (76%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINEAHRVLIDHQRRALYD 66
            :|.|||:..|||..|:|.|:|:|:|:||||||.:..::|.:|::|:.||.|.::|.|||
  Rat     7 YYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLADSKKRELYD 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 27/57 (47%)
DnaJ 7..>66 CDD:223560 27/57 (47%)
Dnaja1NP_075223.1 PTZ00037 2..394 CDD:240236 29/59 (49%)
CXXCXGXG motif 134..141
CXXCXGXG motif 150..157
CXXCXGXG motif 177..184
CXXCXGXG motif 193..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.