DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and DNAJC27

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_057628.1 Gene:DNAJC27 / 51277 HGNCID:30290 Length:273 Species:Homo sapiens


Alignment Length:52 Identity:16/52 - (30%)
Similarity:28/52 - (53%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDK-----NEDGAKEFLRINEA 52
            :|.:.:||:...|:..|:..|:|:|::..||||     :||..|..:....|
Human   216 KDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 16/51 (31%)
DnaJ 7..>66 CDD:223560 16/51 (31%)
DNAJC27NP_057628.1 Required for interaction with MAPK1. /evidence=ECO:0000250|UniProtKB:Q8CFP6 1..18
RJL 17..184 CDD:133319
DnaJ 217..264 CDD:99751 15/46 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.