DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7133 and AgaP_AGAP001859

DIOPT Version :9

Sequence 1:	NP_649379.1	Gene:	CG7133 / 40449	FlyBaseID:	FBgn0037150	Length:	353	Species:	Drosophila melanogaster
Sequence 2:	XP_001238449.2	Gene:	AgaP_AGAP001859 / 4577058	VectorBaseID:	AGAP001859	Length:	385	Species:	Anopheles gambiae

Alignment Length:	63	Identity:	30/63 - (47%)
Similarity:	41/63 - (65%)	Gaps:	2/63 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNE-DGAKE-FLRINEAHRVLIDHQRRALYD 66
            :|.|:|||:.:.|||||||..:::.:||.|||||: .||.| |..:..|...|.|.|:|..||
Mosquito   113 KDFYEVLGVTQEATDSEIKKCYKKHALQLHPDKNKAPGAMEAFKSLGNAVETLTDPQKRKAYD 175

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7133	NP_649379.1	DnaJ	7..66	CDD:278647	28/60 (47%)
CG7133	NP_649379.1	DnaJ	7..>66	CDD:223560	28/60 (47%)
AgaP_AGAP001859	XP_001238449.2	DnaJ	113..>221	CDD:223560	30/63 (48%)
		DnaJ	114..175	CDD:278647	28/60 (47%)
		DUF1977	280..377	CDD:286411
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910