powered by:
Protein Alignment CG7133 and CG6693
DIOPT Version :9
Sequence 1: | NP_649379.1 |
Gene: | CG7133 / 40449 |
FlyBaseID: | FBgn0037150 |
Length: | 353 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262473.1 |
Gene: | CG6693 / 41346 |
FlyBaseID: | FBgn0037878 |
Length: | 299 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 24/65 - (36%) |
Similarity: | 41/65 - (63%) |
Gaps: | 5/65 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDK-----NEDGAKEFLRINEAHRVLIDHQRRALYD 66
|.|:::.|.|.|.:.|:|.|:.:|||..|||: ..:..::|..:::.::||.|.|:|||||
Fly 15 DVYKLMELARGAGEKEVKKAYHKLSLLVHPDRVPEEQKAESTEKFKVLSKLYQVLTDTQKRALYD 79
Fly 67 66
Fly 80 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.