DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and Csp

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster


Alignment Length:203 Identity:50/203 - (24%)
Similarity:70/203 - (34%) Gaps:85/203 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKNE---DGAKEFLRINEAHRVLIDHQRRALYD---- 66
            |::||||:.||..:||..:|:|:|:||||||.   |.|.:|..:|.||.:|.|..:|.:||    
  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYGS 83

  Fly    67 ------------------------------CCFQSMDVEAII----------------------P 79
                                          ||       |:|                      |
  Fly    84 LGLYIAEQFGEENVNAYFVVTSPAVKAVVICC-------AVITGCCCCCCCCCCCNFCCGKFKPP 141

  Fly    80 AENANGQLPELGNP-----------FFPMPPETPPASFREKLKVAAFIGGLLVGTYV-----GYR 128
            ...::.|...|..|           ....||....... :.:.:.|  ||..|.:..     |..
  Fly   142 VNESHDQYSHLNRPDGNREGNDMPTHLGQPPRLEDVDL-DDVNLGA--GGAPVTSQPREQAGGQP 203

  Fly   129 VFQKPPPS 136
            ||..||||
  Fly   204 VFAMPPPS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 27/59 (46%)
DnaJ 7..>66 CDD:223560 27/59 (46%)
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 29/66 (44%)
DnaJ 17..79 CDD:278647 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.