DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and dnajc5gb

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_005158621.1 Gene:dnajc5gb / 393371 ZFINID:ZDB-GENE-040426-1238 Length:212 Species:Danio rerio


Alignment Length:69 Identity:29/69 - (42%)
Similarity:45/69 - (65%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDVYEDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDK---NEDGAKEFLRINEAHRVLIDHQRR 62
            :|...|..||.|||.:.|:..:||.|:|:|:|::||||   |.:.|::|..||.|:.:|.|..:|
Zfish    11 LSRAGESLYQTLGLQKGASSEDIKKAYRKLALKHHPDKNPNNPEAAEKFKEINNANSILNDETKR 75

  Fly    63 ALYD 66
            .:||
Zfish    76 QIYD 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 25/61 (41%)
DnaJ 7..>66 CDD:223560 25/61 (41%)
dnajc5gbXP_005158621.1 DnaJ 14..>86 CDD:223560 28/66 (42%)
DnaJ 17..79 CDD:278647 25/61 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.