DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and DNAJB13

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_011543306.1 Gene:DNAJB13 / 374407 HGNCID:30718 Length:350 Species:Homo sapiens


Alignment Length:101 Identity:37/101 - (36%)
Similarity:49/101 - (48%) Gaps:14/101 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SEIKD-AFRRLSLQYHPDK-NEDGAKE-FLRINEAHRVLIDHQRRALYDCCFQSMDVEAIIPAEN 82
            :|.|| .:|||:|::||.| ||..:.| |.:|.||:.||.|..:|.:|| .|....::..||.| 
Human    51 AEDKDQRYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYD-KFGEEGLKGGIPLE- 113

  Fly    83 ANGQLPELGNPFFPMPPETPPASFREKLKVAAFIGG 118
            ...|.|......|...||   ..|.|      |.||
Human   114 FGSQTPWTTGYVFHGKPE---KVFHE------FFGG 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 21/47 (45%)
DnaJ 7..>66 CDD:223560 21/47 (45%)
DNAJB13XP_011543306.1 DnaJ_bact 48..346 CDD:274090 37/101 (37%)
DnaJ 48..99 CDD:278647 21/47 (45%)
DnaJ_C 174..336 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.