powered by:
Protein Alignment CG7133 and dnj-13
DIOPT Version :9
Sequence 1: | NP_649379.1 |
Gene: | CG7133 / 40449 |
FlyBaseID: | FBgn0037150 |
Length: | 353 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001366737.1 |
Gene: | dnj-13 / 3564910 |
WormBaseID: | WBGene00001031 |
Length: | 331 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 30/63 - (47%) |
Similarity: | 47/63 - (74%) |
Gaps: | 2/63 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKE--FLRINEAHRVLIDHQRRALYD 66
:|:|:|||:.:.|||.|||.|:|:::|:||||||::...| |..|.||:.||.|.:::.:||
Worm 3 KDYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEAGAENKFKEIAEAYDVLSDDKKKKIYD 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.