DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and dnajc4

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_997842.1 Gene:dnajc4 / 324373 ZFINID:ZDB-GENE-030131-3093 Length:237 Species:Danio rerio


Alignment Length:148 Identity:38/148 - (25%)
Similarity:63/148 - (42%) Gaps:23/148 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGA---KEFLRINEAHRVLIDHQRRALYDC- 67
            ::|::||:..:||..:||.||...|.:.|||.:....   .:|:::|||:|||.....|..||. 
Zfish    35 NYYELLGVKPDATLEQIKFAFFDKSKKLHPDSDPSNPGLHTQFVQLNEAYRVLSKEGSRQDYDLR 99

  Fly    68 ---------CFQSMDVEAIIPAENANGQLPELGNPFFPMPPETPPASFREKLKVA-------AFI 116
                     .|::....:..|:..||..: .....|....|:......|||.|..       .|:
Zfish   100 LRYQYAGGQAFRTSSSSSNNPSWEANESM-RYWEQFRQAQPQENTPEEREKKKKRNMRLVGYCFL 163

  Fly   117 GGLL--VGTYVGYRVFQK 132
            ..:|  ...|.|:|..::
Zfish   164 AMILSVSAHYFGFRKLEE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 21/61 (34%)
DnaJ 7..>66 CDD:223560 21/61 (34%)
dnajc4NP_997842.1 DnaJ 35..97 CDD:278647 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.