DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and Dnajb5

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_038966057.1 Gene:Dnajb5 / 313811 RGDID:1307453 Length:420 Species:Rattus norvegicus


Alignment Length:115 Identity:43/115 - (37%)
Similarity:63/115 - (54%) Gaps:15/115 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKN-EDGAKE-FLRINEAHRVLIDHQRRALYDCC 68
            :|:|::||:|..|.:.|||.|:|:::|:|||||| |..|:| |..|.||:.||.|.::|:|||  
  Rat    75 KDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYD-- 137

  Fly    69 FQSMDVEAIIPAENANGQLPELGNPFFPMPPETPPASFREKLKVAAFIGG 118
              ....|.:   :...|.....|..|.......|.|:|      |:|.||
  Rat   138 --QYGEEGL---KTGGGTSGGSGGSFHYTFHGDPHATF------ASFFGG 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 30/60 (50%)
DnaJ 7..>66 CDD:223560 30/60 (50%)
Dnajb5XP_038966057.1 DnaJ 72..415 CDD:223560 43/115 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.