DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and Dnaja4

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001020582.1 Gene:Dnaja4 / 300721 RGDID:1310035 Length:555 Species:Rattus norvegicus


Alignment Length:59 Identity:27/59 - (45%)
Similarity:44/59 - (74%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINEAHRVLIDHQRRALYD 66
            :|.:||:..:|:..|||.|:|:|:|:||||||.|..::|..|::|:.||.|.::|.:||
  Rat   165 YYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDIYD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 25/57 (44%)
DnaJ 7..>66 CDD:223560 25/57 (44%)
Dnaja4NP_001020582.1 PTZ00037 144..552 CDD:240236 27/59 (46%)
DnaJ 165..223 CDD:278647 25/57 (44%)
DnaJ_C 264..490 CDD:199909
DnaJ_zf 293..359 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.