DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and Dnaja4

DIOPT Version :10

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001020582.1 Gene:Dnaja4 / 300721 RGDID:1310035 Length:555 Species:Rattus norvegicus


Alignment Length:59 Identity:27/59 - (45%)
Similarity:44/59 - (74%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINEAHRVLIDHQRRALYD 66
            :|.:||:..:|:..|||.|:|:|:|:||||||.|..::|..|::|:.||.|.::|.:||
  Rat   165 YYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEKFKLISQAYEVLSDPKKRDIYD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:395170 25/57 (44%)
Dnaja4NP_001020582.1 PHA03247 8..>126 CDD:223021
PTZ00037 144..552 CDD:240236 27/59 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.