Protein Alignment CG7133 and Dnajc27

DIOPT Version :9

• Sequence 1: NP_649379.1
• Gene: CG7133 / 40449
• FlyBaseID: FBgn0037150
• Length: 353
• Species: Drosophila melanogaster
• Sequence 2: NP_996727.2
• Gene: Dnajc27 / 298859
• RGDID: 1564414
• Length: 273
• Species: Rattus norvegicus
• Alignment Length: 52
• Identity: 16/52 - (30%)
• Similarity: 29/52 - (55%)
• Gaps: 5/52 - (9%)

  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDK-----NEDGAKEFLRINEA 52
            :|.:::||:...|:..|:..|:|:|::..||||     :||..|..:....|
  Rat   216 KDSWEMLGVRPGASREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTA 267

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG7133	NP_649379.1	DnaJ	7..66	CDD:278647	16/51 (31%)
		DnaJ	7..>66	CDD:223560	16/51 (31%)
Dnajc27	NP_996727.2	Required for interaction with MAPK1. /evidence=ECO:0000250|UniProtKB:Q8CFP6	1..18
		RJL	17..184	CDD:133319
		DnaJ	217..264	CDD:99751	15/46 (33%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910