DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and Dnajc18

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_006254608.1 Gene:Dnajc18 / 291677 RGDID:1310237 Length:357 Species:Rattus norvegicus


Alignment Length:106 Identity:37/106 - (34%)
Similarity:52/106 - (49%) Gaps:24/106 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKN-EDGAKE-FLRINEAHRVLIDHQRRALYDCCF 69
            ::|.:||:..||:|.|:|.|:::|:|::||||| ..||.: |..|..|..||.:..:|..||...
  Rat    82 NYYDILGVSHNASDEELKKAYKKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRLRYDEYG 146

  Fly    70 QSM---------------DVEAIIPAENANGQLPELGNPFF 95
            ...               ||||.|..|       ||.|.||
  Rat   147 DEQVTLTAPRARPYHYYRDVEADISPE-------ELFNVFF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 24/60 (40%)
DnaJ 7..>66 CDD:223560 24/60 (40%)
Dnajc18XP_006254608.1 DnaJ 82..143 CDD:278647 24/60 (40%)
DUF1977 250..349 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.