DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and SPBC543.02c

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_596790.1 Gene:SPBC543.02c / 2541066 PomBaseID:SPBC543.02c Length:476 Species:Schizosaccharomyces pombe


Alignment Length:144 Identity:45/144 - (31%)
Similarity:67/144 - (46%) Gaps:35/144 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNE---DGAKEFLRINEAHRVLIDHQRRALYDC 67
            :|||::||:.:.|||.|||.|:|:|:|.||||||.   :....|..:.||:.:|.|.:.|..:| 
pombe   348 KDHYKILGVSKEATDIEIKKAYRKLALVYHPDKNAGNLEAEARFKEVGEAYTILSDPESRRRFD- 411

  Fly    68 CFQSMDVEA------------IIPAENANGQLPELGNP---FFPMPPETPPASFREKLKVAAFIG 117
              ..:|:|.            |:.|..|.|..|..|.|   |       |..|:..:       |
pombe   412 --SGVDLEPGMEGGAGMDPFDILRAYQAGGSFPGGGFPGGGF-------PGGSYNSQ-------G 460

  Fly   118 GLLVGTYVGYRVFQ 131
            ..:.|.:.|:..||
pombe   461 FGMGGGFPGFTSFQ 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 27/61 (44%)
DnaJ 7..>66 CDD:223560 27/61 (44%)
SPBC543.02cNP_596790.1 TPR_11 23..90 CDD:290150
TPR repeat 23..51 CDD:276809
TPR_1 29..52 CDD:278916
TPR repeat 56..88 CDD:276809
TPR repeat 93..117 CDD:276809
TPR repeat 146..171 CDD:276809
TPR_11 147..208 CDD:290150
TPR_11 176..254 CDD:290150
TPR_2 177..210 CDD:285020
TPR repeat 177..205 CDD:276809
TPR 227..256 CDD:197478
TPR repeat 227..251 CDD:276809
TPR repeat 256..290 CDD:276809
TPR_11 261..325 CDD:290150
TPR repeat 295..323 CDD:276809
DnaJ 348..>430 CDD:223560 30/84 (36%)
DnaJ 349..411 CDD:278647 27/61 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24074
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.