powered by:
Protein Alignment CG7133 and sec63
DIOPT Version :9
Sequence 1: | NP_649379.1 |
Gene: | CG7133 / 40449 |
FlyBaseID: | FBgn0037150 |
Length: | 353 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_595985.1 |
Gene: | sec63 / 2540961 |
PomBaseID: | SPBC36B7.03 |
Length: | 611 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 70 |
Identity: | 22/70 - (31%) |
Similarity: | 40/70 - (57%) |
Gaps: | 11/70 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDK--------NEDGAKEFLRINEAHRVLIDHQRR- 62
|.|::||:.:..:..:::..::|||:::|||| .|:..|.::.|..|:|.|.|.:.|
pombe 98 DPYEILGIAKGTSVDDVRRHYKRLSIKFHPDKVRNMVNTTREEVEKHYIEITNAYRALTDDKTRE 162
Fly 63 --ALY 65
|||
pombe 163 NYALY 167
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
1 | 0.960 |
|
Return to query results.
Submit another query.