DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and sec63

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_595985.1 Gene:sec63 / 2540961 PomBaseID:SPBC36B7.03 Length:611 Species:Schizosaccharomyces pombe


Alignment Length:70 Identity:22/70 - (31%)
Similarity:40/70 - (57%) Gaps:11/70 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDK--------NEDGAKEFLRINEAHRVLIDHQRR- 62
            |.|::||:.:..:..:::..::|||:::||||        .|:..|.::.|..|:|.|.|.:.| 
pombe    98 DPYEILGIAKGTSVDDVRRHYKRLSIKFHPDKVRNMVNTTREEVEKHYIEITNAYRALTDDKTRE 162

  Fly    63 --ALY 65
              |||
pombe   163 NYALY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 22/70 (31%)
DnaJ 7..>66 CDD:223560 22/70 (31%)
sec63NP_595985.1 SEC63 1..611 CDD:227694 22/70 (31%)
DnaJ 98..164 CDD:278647 19/65 (29%)
Sec63 229..541 CDD:214946
Nro1 <543..>599 CDD:289519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.