DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and SPBC1347.05c

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_596697.3 Gene:SPBC1347.05c / 2540021 PomBaseID:SPBC1347.05c Length:398 Species:Schizosaccharomyces pombe


Alignment Length:177 Identity:52/177 - (29%)
Similarity:80/177 - (45%) Gaps:47/177 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDK---NEDGAKEFLRINEAHRVLIDHQRRALYDCC 68
            |:||:||:.::|::|||:.|:|:|:.|:||||   ||:..::|:.||:||.||.|.::|.:||..
pombe    24 DYYQILGVSKDASESEIRKAYRQLTKQWHPDKNPGNEEAQEKFIEINKAHEVLSDPEQRKIYDAY 88

  Fly    69 FQSMDVEAIIPAENANGQLPELGNPFFPMPPETPPASFREKLKVAAFIGGLLVGTYVGY------ 127
            .:          |..|||         |..|...|..        .|.||       |:      
pombe    89 GE----------EGLNGQ---------PGGPGGGPGE--------GFPGG-------GFGFDPFG 119

  Fly   128 ----RVFQKPPPSIPVPRPIPTQELSDSHLGSLWTLSSGLLALRSKR 170
                .:|........|.|....:::...||.|.:|..|..|.:..||
pombe   120 DIFDNIFGGRRRQNAVRRGPSMEQIVQIHLSSFYTGGSFTLEIPVKR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 28/61 (46%)
DnaJ 7..>66 CDD:223560 28/61 (46%)
SPBC1347.05cNP_596697.3 DnaJ 20..389 CDD:223560 52/177 (29%)
DnaJ 24..86 CDD:278647 28/61 (46%)
DnaJ_zf 168..237 CDD:199908
DnaJ_C 236..376 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.