DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and mug184

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_595124.1 Gene:mug184 / 2540016 PomBaseID:SPBC1773.09c Length:551 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:30/72 - (41%)
Similarity:42/72 - (58%) Gaps:4/72 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDVYEDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKN----EDGAKEFLRINEAHRVLIDHQRR 62
            :|...|:|.:|.|.:|||..:|:..:..|:||||||:|    |...|.|.|:..||.||.|..:|
pombe     7 TDTSVDYYAILKLQKNATFQQIRKQYLFLALQYHPDRNPGDEERAVKRFQRLQLAHEVLSDATKR 71

  Fly    63 ALYDCCF 69
            .:||..|
pombe    72 LIYDQLF 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 26/62 (42%)
DnaJ 7..>66 CDD:223560 26/62 (42%)
mug184NP_595124.1 DnaJ 11..>79 CDD:223560 29/68 (43%)
DnaJ 12..75 CDD:278647 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.