DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7133 and mas5

DIOPT Version :9

Sequence 1:	NP_649379.1	Gene:	CG7133 / 40449	FlyBaseID:	FBgn0037150	Length:	353	Species:	Drosophila melanogaster
Sequence 2:	NP_595428.1	Gene:	mas5 / 2539671	PomBaseID:	SPBC1734.11	Length:	407	Species:	Schizosaccharomyces pombe

Alignment Length:	58	Identity:	25/58 - (43%)
Similarity:	41/58 - (70%)	Gaps:	0/58 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINEAHRVLIDHQRRALYD 66
            |:||.:...|:.:|:|.|:|:|:|:||||||.:...:|..|:.|:.:|.|.::||.||
pombe     8 YEVLNVDVTASQAELKKAYRKLALKYHPDKNPNAGDKFKEISRAYEILADEEKRATYD 65

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7133	NP_649379.1	DnaJ	7..66	CDD:278647	23/56 (41%)
CG7133	NP_649379.1	DnaJ	7..>66	CDD:223560	23/56 (41%)
mas5	NP_595428.1	DnaJ	2..357	CDD:223560	25/58 (43%)
		DnaJ	7..65	CDD:278647	23/56 (41%)
		DnaJ_C	108..331	CDD:199909
		DnaJ_zf	137..202	CDD:199908
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0712
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900