DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and CG30156

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001260752.1 Gene:CG30156 / 246488 FlyBaseID:FBgn0050156 Length:358 Species:Drosophila melanogaster


Alignment Length:113 Identity:42/113 - (37%)
Similarity:58/113 - (51%) Gaps:21/113 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDVYE------DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNED-GAKE-FLRINEAHRVLI 57
            |.||.:      :||:||.:..:||.||:|.|:.:|:|:.|||||:. ||:: |.||:||...|.
  Fly    84 MLDVVQKVLRCRNHYEVLRISHHATYSEVKRAYHKLALRLHPDKNKSPGAEQAFRRISEAADCLT 148

  Fly    58 DHQRRALY-------DCCFQS----MDVEAIIPAENANGQLPELGNPF 94
            |.|:|..|       ||..|.    .|.........|||.  :||..|
  Fly   149 DCQKRIEYNIATAVGDCHDQDPSQYKDYRGESEFNEANGN--DLGAAF 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 29/67 (43%)
DnaJ 7..>66 CDD:223560 29/67 (43%)
CG30156NP_001260752.1 DnaJ 96..157 CDD:278647 28/60 (47%)
DUF1977 237..334 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.