DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7133 and Dnajb6

DIOPT Version :9

Sequence 1:	NP_649379.1	Gene:	CG7133 / 40449	FlyBaseID:	FBgn0037150	Length:	353	Species:	Drosophila melanogaster
Sequence 2:	NP_001365764.1	Gene:	Dnajb6 / 23950	MGIID:	1344381	Length:	372	Species:	Mus musculus

Alignment Length:	117	Identity:	39/117 - (33%)
Similarity:	61/117 - (52%)	Gaps:	17/117 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 DHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKN----EDGAKEFLRINEAHRVLIDHQRRALYDC 67
            |:|:|||:.|:|:..:||.|:|:.:|::|||||    |:..::|.::.||:.||.|.::|.:||
Mouse     3 DYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYD- 66

  Fly    68 CFQSMDVEAIIPAENANGQLPELGNPF-FPMPPETPPASFREKLKVAAFIGG 118
               ....|.:.......|  ....:|| |......|...|||      |.||
Mouse    67 ---KYGKEGLNGGGGGGG--IHFDSPFEFGFTFRNPDDVFRE------FFGG 107

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7133	NP_649379.1	DnaJ	7..66	CDD:278647	25/62 (40%)
CG7133	NP_649379.1	DnaJ	7..>66	CDD:223560	25/62 (40%)
Dnajb6	NP_001365764.1	Interaction with HSP70. /evidence=ECO:0000250	1..147		39/117 (33%)
		DnaJ	2..>138	CDD:223560	39/117 (33%)
		Interaction with KRT18. /evidence=ECO:0000250	120..235
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000