powered by:
Protein Alignment CG7133 and Dnajc27
DIOPT Version :9
Sequence 1: | NP_649379.1 |
Gene: | CG7133 / 40449 |
FlyBaseID: | FBgn0037150 |
Length: | 353 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006515115.1 |
Gene: | Dnajc27 / 217378 |
MGIID: | 2443036 |
Length: | 298 |
Species: | Mus musculus |
Alignment Length: | 52 |
Identity: | 16/52 - (30%) |
Similarity: | 29/52 - (55%) |
Gaps: | 5/52 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDK-----NEDGAKEFLRINEA 52
:|.:::||:...|:..|:..|:|:|::..|||| :||..|..:....|
Mouse 241 KDSWEMLGVRPGASREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTA 292
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7133 | NP_649379.1 |
DnaJ |
7..66 |
CDD:278647 |
16/51 (31%) |
DnaJ |
7..>66 |
CDD:223560 |
16/51 (31%) |
Dnajc27 | XP_006515115.1 |
RJL |
17..209 |
CDD:133319 |
|
DnaJ |
242..289 |
CDD:99751 |
15/46 (33%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.