DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and F54F2.9

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_498949.2 Gene:F54F2.9 / 176241 WormBaseID:WBGene00018836 Length:414 Species:Caenorhabditis elegans


Alignment Length:361 Identity:69/361 - (19%)
Similarity:130/361 - (36%) Gaps:92/361 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDVYEDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNE--DGAKEFLRINEAHRVLIDHQRRA 63
            :.:|..:.|:...:||:|:.:::|.|:|:|:|::|||:|.  |..::|.::...:.||...:.|.
 Worm    29 VEEVGVNFYEWFDIPRDASSNQVKKAYRKLTLEWHPDRNSAPDATEKFRQVAGIYEVLKTTELRE 93

  Fly    64 LYDCCFQSMDVEAIIPAENANGQLPELGNPFFPMPPETPPASFREKLKVAAFIGGLLVGTYVG-- 126
            .||...:             || ||...:|.:          :..:::..|:..|:||..::|  
 Worm    94 KYDNVLE-------------NG-LPSWRHPMY----------YYRRMRKLAWYEGILVLLFIGTI 134

  Fly   127 ----------------YRVFQKPPPSIPVPRPIPTQELSDSHLGSLWTLSSGLLALRSKRILGLG 175
                            |:...|.........|...::|....|.......|.||.:    ||..|
 Worm   135 AHYLMMWAAYFEKTLVYKQNVKKSRKSKKEDPAEAEKLMKQALEEYLPKYSELLPI----ILARG 195

  Fly   176 KLAPWANTRVSPRTLNAPFSSAAKVVAKTVIRGQRAVGSSATSSSSLASAANVAVKSLPSKASVN 240
            .:..:.|..::.:....|.....:...:..:..||....:|.:...|.....||           
 Worm   196 TVTLFKNLALTAKDAMTPKEVEPEEPTEEELAQQRRQQRAAAAPQQLEFKFEVA----------- 249

  Fly   241 SATETVAKTLSQGSRA---------GPYSALKTVWSSAVSYLRSLLNWATTPKWGKATPATIAGL 296
                       ||.:|         ..|:|...|    |:..:|...|         ||..:|.|
 Worm   250 -----------QGMKAVSTNDPEMEKKYAAENEV----VAQKQSGATW---------TPDELASL 290

  Fly   297 VHNSRPVWSSAAKNTLAALMYACSKISSYLRALAGR 332
            |..|...:.:...|....:....::.:..:.|:||:
 Worm   291 VRLSTEKYPAGTPNRWEQMGRVLNRSAEDVIAMAGK 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 18/60 (30%)
DnaJ 7..>66 CDD:223560 18/60 (30%)
F54F2.9NP_498949.2 DnaJ 35..96 CDD:278647 18/60 (30%)
SANT 357..402 CDD:238096
SANT 357..402 CDD:197842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.