DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and dnj-10

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_498902.1 Gene:dnj-10 / 176211 WormBaseID:WBGene00001028 Length:456 Species:Caenorhabditis elegans


Alignment Length:63 Identity:24/63 - (38%)
Similarity:39/63 - (61%) Gaps:2/63 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDHYQVLGLPRNATDSEIKDAFRRLSLQYHPD--KNEDGAKEFLRINEAHRVLIDHQRRALYD 66
            ||:|:.||:.:.:....||.|:.:|:.:||||  |.::...:|..|:||:.||.|..:|..||
 Worm    43 EDYYKTLGVDKKSDAKAIKKAYFQLAKKYHPDVNKTKEAQTKFQEISEAYEVLSDDTKRQEYD 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 21/60 (35%)
DnaJ 7..>66 CDD:223560 21/60 (35%)
dnj-10NP_498902.1 DnaJ 41..387 CDD:223560 24/63 (38%)
DnaJ 44..105 CDD:278647 21/60 (35%)
DnaJ_C 165..372 CDD:199909
DnaJ_zf 191..252 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.