DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7133 and dnj-4

DIOPT Version :9

Sequence 1:NP_649379.1 Gene:CG7133 / 40449 FlyBaseID:FBgn0037150 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_491558.1 Gene:dnj-4 / 172173 WormBaseID:WBGene00001022 Length:274 Species:Caenorhabditis elegans


Alignment Length:98 Identity:34/98 - (34%)
Similarity:43/98 - (43%) Gaps:15/98 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYQVLGLPRNATDSEIKDAFRRLSLQYHPDKN--EDGAKEFLRINEAHRVLIDHQRRALYDCCFQ 70
            ||:|||:...||.||||.||...|.:.|||.:  |.....||.:..|:.||.....|.|||  :|
 Worm    29 HYEVLGVESTATLSEIKSAFYAQSKKVHPDNSSEESATASFLELKNAYDVLRRPADRRLYD--YQ 91

  Fly    71 SMDVEAIIPAENANGQLPELGNPFFPMPPETPP 103
                     .....|:.|..|..:  ..|.|.|
 Worm    92 ---------LRGGGGRYPNGGQRY--QYPNTAP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7133NP_649379.1 DnaJ 7..66 CDD:278647 25/59 (42%)
DnaJ 7..>66 CDD:223560 25/59 (42%)
dnj-4NP_491558.1 CbpA 27..>155 CDD:225124 34/98 (35%)
DnaJ 28..89 CDD:365959 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.